PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca45788.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 159aa    MW: 18647.2 Da    PI: 9.5218
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca45788.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.4e-5481361128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPt+eelv +yLk+k+++ ++el +vi ++d+y++ePwd++ k    ++e++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk+vls k
  Dca45788.1   8 VPPGFRFHPTEEELVGYYLKRKINSLNFEL-DVIVDIDLYRMEPWDIEdKckLGYSEQNEWYFFSHKDRKYPTGTRTNRATAAGFWKATGRDKAVLS-K 104
                 69****************************.99**************843432334778**************************************.9 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 +  +g++ktLvfykgrap+g+k+dW+mheyrl
  Dca45788.1 105 NVMIGMRKTLVFYKGRAPNGRKSDWIMHEYRL 136
                 999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-575142IPR003441NAC domain
PROSITE profilePS5100553.5538156IPR003441NAC domain
PfamPF023653.1E-299136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MAHIESCVPP GFRFHPTEEE LVGYYLKRKI NSLNFELDVI VDIDLYRMEP WDIEDKCKLG  60
YSEQNEWYFF SHKDRKYPTG TRTNRATAAG FWKATGRDKA VLSKNVMIGM RKTLVFYKGR  120
APNGRKSDWI MHEYRLQTTE HAPPQASFIL LFTSNRSNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-4821369140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678128.14e-97PREDICTED: NAC domain-containing protein 76
SwissprotQ9C8W96e-90NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A0J8D6W04e-97A0A0J8D6W0_BETVU; Uncharacterized protein
STRINGSolyc06g065410.2.13e-94(Solanum lycopersicum)
STRINGPGSC0003DMT4000670864e-94(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.15e-80vascular related NAC-domain protein 7